Iright
BRAND / VENDOR: Proteintech

Proteintech, 21932-1-AP, SLC14A2 Polyclonal antibody

CATALOG NUMBER: 21932-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC14A2 (21932-1-AP) by Proteintech is a Polyclonal antibody targeting SLC14A2 in WB, ELISA applications with reactivity to human, mouse samples 21932-1-AP targets SLC14A2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SLC14A2, also known as human urea transporter -2 (HUT2), is the human homolog of UT-A2 and the only kidney-specific urea transporter cloned in humans. Urea transport in the kidney is mediated by a family of transporter proteins, including renal urea transporters (UT-A) and erythrocyte urea transporters (UT-B). UT-A proteins expressed in the kidney play a critical role in generating the hypertonic medulla, which is an integral component of the urinary concentrating mechanism (PMID: 11590132, 11880324). The 4.2-kb hUT-A1 cDNA encodes a 920-amino acid peptide, which is 89% identical to the rat UT-A1 protein (PMID: 11502588). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16561 Product name: Recombinant human SLC14A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 431-610 aa of BC110445 Sequence: EANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSGILIILGLFIQ Predict reactive species Full Name: solute carrier family 14 (urea transporter), member 2 Calculated Molecular Weight: 920 aa, 101 kDa Observed Molecular Weight: 43 kDa, 101 kDa GenBank Accession Number: BC110445 Gene Symbol: SLC14A2 Gene ID (NCBI): 8170 RRID: AB_3085679 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15849 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924