Proteintech, 21951-1-AP, Urocortin Polyclonal antibody

Size: 20ul / 150ul The Urocortin (21951-1-AP) by Proteintech is a Polyclonal antibody targeting Urocortin in IHC, ELISA applications with reactivity to human samples 21951-1-AP targets Urocortin in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human testis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Urocortin is a member of the sauvagine/corticotropin-releasing factor/urotensin I family that includes CRF, urotensin I, sauvagine, urocortin II and urocortin III. . Urocortin is a potent anorexigenic peptide that induces fed-like motor activity when administered centrally or peripherally in fasted animals. Urocortin is also a potent and long-lasting hypotensive agent and increases coronary blood flow. Urocortin acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH) and binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta. Urocortin is synthesized as precursor, which is subsequently processed to the mature biologically active peptide (a 40-amino acid Molecule ). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15995 Product name: Recombinant human UCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC104470 Sequence: MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK Predict reactive species Full Name: urocortin Calculated Molecular Weight: 124 aa, 13 kDa GenBank Accession Number: BC104470 Gene Symbol: UCN Gene ID (NCBI): 7349 RRID: AB_2878953 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P55089 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.