Iright
BRAND / VENDOR: Proteintech

Proteintech, 21952-1-AP, NCOA1/SRC-1 Polyclonal antibody

CATALOG NUMBER: 21952-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NCOA1/SRC-1 (21952-1-AP) by Proteintech is a Polyclonal antibody targeting NCOA1/SRC-1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 21952-1-AP targets NCOA1/SRC-1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Nuclear receptor coactivator 1, also named SRC-1, directly binds nuclear receptors and stimulates transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR, and ER), retinoids (RXRs), thyroid hormone (TRs), and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B, and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via the remodeling of chromatin, and possibly act by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16603 Product name: Recombinant human NCOA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1122-1441 aa of BC111533 Sequence: RQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE Predict reactive species Full Name: nuclear receptor coactivator 1 Calculated Molecular Weight: 1441 aa, 157 kDa Observed Molecular Weight: 140-160 kDa GenBank Accession Number: BC111533 Gene Symbol: SRC 1/NCOA1 Gene ID (NCBI): 8648 RRID: AB_2935455 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q15788 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924