Iright
BRAND / VENDOR: Proteintech

Proteintech, 21959-1-AP, FTCD Polyclonal antibody

CATALOG NUMBER: 21959-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FTCD (21959-1-AP) by Proteintech is a Polyclonal antibody targeting FTCD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21959-1-AP targets FTCD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:4000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information FTCD (formimidoyltransferase cyclodeaminase) is critical for the catabolism of histidine, a . This process is one-carbon units that can enter the one-carbon/folate cycle, which provides methyl groups for arsenic metabolism (PMID: 30893314). In addition, FTCD could serve as a predictive and prognostic marker for patients with HCC (PMID: 37675273). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16646 Product name: Recombinant human FTCD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 192-541 aa of BC136395 Sequence: TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE Predict reactive species Full Name: formiminotransferase cyclodeaminase Calculated Molecular Weight: 541 aa, 59 kDa Observed Molecular Weight: 53-62 kDa GenBank Accession Number: BC136395 Gene Symbol: FTCD Gene ID (NCBI): 10841 RRID: AB_11182396 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95954 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924