Proteintech, 21980-1-AP, ZNF560 Polyclonal antibody

Size: 20ul / 150ul The ZNF560 (21980-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF560 in IF/ICC, ELISA applications with reactivity to human samples 21980-1-AP targets ZNF560 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HEK-293 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Zinc Finger Protein 560 (ZNF560) is a member of the Krüppel-type (C2H2) zinc finger protein family, characterized by multiple zinc finger domains that mediate DNA binding and transcriptional regulation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15921 Product name: Recombinant human ZNF560 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 186-395 aa of BC101040 Sequence: GPALWQDNFCLKTLNGIQLARNQNGEELYDCKQCEDVFCKHPCLKTNMSTQNRGNTSECIQYAKDLLSLYNKTSTIRKVSVFSKHGKSFRLILNVQVQRKCTQDKSFEGTDYGKAFIYQSYLEAHRKTQSGEKLNEWKQCGEAFTHSTSHAVNVETHIIKNPYECKECGKDFRYPTHLNNHMQTHIGIKPYKCKHCGKTFTVPSGFLEHV Predict reactive species Full Name: zinc finger protein 560 Calculated Molecular Weight: 790 aa, 91 kDa GenBank Accession Number: BC101040 Gene Symbol: ZNF560 Gene ID (NCBI): 147741 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MR9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.