Iright
BRAND / VENDOR: Proteintech

Proteintech, 21983-1-AP, TSPAN9 Polyclonal antibody

CATALOG NUMBER: 21983-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TSPAN9 (21983-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN9 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 21983-1-AP targets TSPAN9 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse peripheral blood leukocyte, mouse spleen tissue, rat spleen tissue Positive IP detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TSPAN9 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN9 is relatively highly expressed in the megakaryocyte/platelet lineage and has a role in regulating platelet function in concert with other platelet tetraspanins and their associated proteins. TSPAN9 has been identified as a glycoprotein (PMID: 18795891). This polyclonal antibody detects endogenous TSPAN9 at a band of 29-33 kDa, which is larger than the calculated molecular weight of TSPAN9 (27 kDa), probably due to glycosylation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17048 Product name: Recombinant human TSPAN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-239 aa of BC071881 Sequence: LLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHIHRTGKKYDA Predict reactive species Full Name: tetraspanin 9 Calculated Molecular Weight: 239 aa, 27 kDa Observed Molecular Weight: 29-33 kDa GenBank Accession Number: BC071881 Gene Symbol: TSPAN9 Gene ID (NCBI): 10867 RRID: AB_2878960 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75954 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924