Iright
BRAND / VENDOR: Proteintech

Proteintech, 21996-1-AP, OSCAR Polyclonal antibody

CATALOG NUMBER: 21996-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The OSCAR (21996-1-AP) by Proteintech is a Polyclonal antibody targeting OSCAR in WB, ELISA applications with reactivity to human samples 21996-1-AP targets OSCAR in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Osteoclast-associated receptor (OSCAR) is an FcRγ-associated receptor that belongs to the leukocyte receptor cluster (LRC). OSCAR is expressed by myeloid cells and is involved in antigen presentation and activation of human dendritic cells(PMID: 15155468; PMID: 15650060). OSCAR is expressed in osteoclast cells and involved in the differentiation of osteoclasts from peripheral blood mononuclear cells (PBMC). The N-glycosylated form of human OSCAR has a molecular weight of approximately 40-45 kDa, while 30 kDa corresponds to its fully non-glycosylated form (PMID: 15155468; 24902903; 27917924) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17366 Product name: Recombinant human OSCAR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-282 aa of BC035023 Sequence: NVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV Predict reactive species Full Name: osteoclast associated, immunoglobulin-like receptor Calculated Molecular Weight: 282 aa, 31 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC035023 Gene Symbol: OSCAR Gene ID (NCBI): 126014 RRID: AB_3669383 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYS5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924