Proteintech, 22004-1-AP, MYCT1 Polyclonal antibody

Size: 20ul / 150ul The MYCT1 (22004-1-AP) by Proteintech is a Polyclonal antibody targeting MYCT1 in WB, ELISA applications with reactivity to human, mouse samples 22004-1-AP targets MYCT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4800 Product name: Recombinant human MYCT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC022556 Sequence: LAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPWPENFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGLNRTGFYGHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS Predict reactive species Full Name: myc target 1 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC022556 Gene Symbol: MYCT1 Gene ID (NCBI): 80177 RRID: AB_2878968 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8N699 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.