Proteintech, 22018-1-AP, N-cadherin Polyclonal antibody

Size: 20ul / 150ul The N-cadherin (22018-1-AP) by Proteintech is a Polyclonal antibody targeting N-cadherin in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 22018-1-AP targets N-cadherin in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, A549 cells, C2C12 cells, HEK-293 cells, HeLa cells, rat brain tissue, HepG2 cells, NCI-H1299 cells, C6 cells, NIH/3T3 cells, PC-3 cells, rat heart tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue, C2C12 cells Positive IF-Fro detected in: mouse heart tissue Positive IF/ICC detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Neuronal cadherin (N-cadherin), also known as cadherin-2 (CDH2), is a calcium-binding protein that mediates cell-cell adhesions of neuronal and some non-neuronal cell types.What is the molecular weight of N-cadherin? Is N-cadherin post-translationally modified?The molecular weight of mature N-cadherin is 127 kDa. N-cadherin is synthesized in a precursor form that undergoes proteolytic cleavage by furin at the Golgi apparatus. Additionally, it can be phosphorylated by casein kinase II and N-glycosylated, which affects its stability (PMID: 12604612 and 19846557).What is the subcellular localization of N-cadherin? What is the tissue expression pattern of N-cadherin?N-cadherin is an integral membrane protein present at the plasma membrane, forming adherens junctions. It is widely expressed in the nervous system, where it flanks the active zone of synapses and is important for synapse formation and remodeling. It is also present in the lens, skeletal, and cardiac muscles (PMID: 3857614). In the muscle, N-cadherin plays a role in myoblast differentiation, while in the heart it is required for the formation of intercalated discs. Additionally, N-cadherin is present in blood vessels, promoting angiogenesis by forming adhesive complexes between endothelial cells and pericytes (PMID: 24521477).What is the role of N-cadherin during the epithelial-mesenchymal transition (EMT)?EMT is a crucial process during gastrulation that leads to the formation of mesenchymal cells. It is marked by decreased expression of E-cadherin and upregulation of N-cadherin, which promotes cell migration (PMID: 23481201). Similarly, upregulation of N-cadherin is observed in many cancer cell types and is associated with increased invasiveness and metastasis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine, bovine, hamster, horse, gecko Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16792 Product name: Recombinant human N-cadherin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 421-535 aa of BC036470 Sequence: RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT Predict reactive species Full Name: cadherin 2, type 1, N-cadherin (neuronal) Calculated Molecular Weight: 906 aa, 100 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC036470 Gene Symbol: N-cadherin Gene ID (NCBI): 1000 RRID: AB_2813891 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19022 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.