Proteintech, 22022-1-AP, DRD2 Polyclonal antibody

Size: 20ul / 150ul The DRD2 (22022-1-AP) by Proteintech is a Polyclonal antibody targeting DRD2 in IHC, ELISA applications with reactivity to human, mouse samples 22022-1-AP targets DRD2 in IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16821 Product name: Recombinant human DRD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 200-384 aa of BC021195 Sequence: VPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFII Predict reactive species Full Name: dopamine receptor D2 Calculated Molecular Weight: 443 aa, 51 kDa GenBank Accession Number: BC021195 Gene Symbol: DRD2 Gene ID (NCBI): 1813 RRID: AB_2878972 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14416 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.