Iright
BRAND / VENDOR: Proteintech

Proteintech, 22025-1-AP, ARPC5L Polyclonal antibody

CATALOG NUMBER: 22025-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ARPC5L (22025-1-AP) by Proteintech is a Polyclonal antibody targeting ARPC5L in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 22025-1-AP targets ARPC5L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, NIH/3T3 cells, mouse lung tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ARPC5L, also known as ARC16-2, belongs to the ARPC5 family. ARPC5L is involved in Arp2/3 complex-mediated actin nucleation and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ARPC5L-containing Arp2/3 complexes are required for the peripheral positioning of nuclei in myofibers (PMID: 28892082). The molecular mass of ARPC5L is 17-20 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16881 Product name: Recombinant human ARPC5L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC000798 Sequence: MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV Predict reactive species Full Name: actin related protein 2/3 complex, subunit 5-like Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC000798 Gene Symbol: ARPC5L Gene ID (NCBI): 81873 RRID: AB_11182273 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BPX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924