Proteintech, 22031-1-AP, Vimentin Polyclonal antibody

Size: 20ul / 150ul The Vimentin (22031-1-AP) by Proteintech is a Polyclonal antibody targeting Vimentin in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 22031-1-AP targets Vimentin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells, A549 cells, HEK-293 cells, mouse heart tissue, HeLa cells, Jurkat cells, rat heart tissue Positive IF-P detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Vimentin, also named as VIM, belongs to the intermediate filament family. Vimentin is class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is important for stabilizing the architecture of the cytoplasm. Monocyte-derived macrophages secrete vimentin into the extracellular space in vitro. Secretion of vimentin was enhanced by the proinflammatory cytokine tumor necrosis factor-alpha (TNFA; 191160) and inhibited by the antiinflammatory cytokine IL10 (124092), suggesting that vimentin is involved in the immune response. Vimentin has specialized functions that contribute to specific dynamic cellular processes. As a phosphoprotein, 55-60 kDa of vimentin proteins can be observed due to the different phosphorylation level. Isoforms of vimentin (49 kDa and 60 kDa) had also been reported. (PMID: 8640945, 22728585). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16898 Product name: Recombinant human Vimentin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC000163 Sequence: MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDF Predict reactive species Full Name: vimentin Calculated Molecular Weight: 466 aa, 54 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC000163 Gene Symbol: VIM Gene ID (NCBI): 7431 ENSEMBL Gene ID: ENSG00000026025 RRID: AB_11182825 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08670 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.