Proteintech, 22037-1-AP, BIM/BCL2L11 Polyclonal antibody

Size: 20ul / 150ul The Bim (22037-1-AP) by Proteintech is a Polyclonal antibody targeting Bim in WB, IHC, ELISA applications with reactivity to human, mouse samples 22037-1-AP targets Bim in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, Raji cells Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11875 Product name: Recombinant human BIM, BCL2L11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-198 aa of BC033694 Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH Predict reactive species Full Name: BCL2-like 11 (apoptosis facilitator) Calculated Molecular Weight: 198 aa, 22 kDa Observed Molecular Weight: 23 and 18 kDa GenBank Accession Number: BC033694 Gene Symbol: Bim Gene ID (NCBI): 10018 RRID: AB_2878978 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43521 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.