Proteintech, 22042-1-AP, CALHM1 Polyclonal antibody

Size: 20ul / 150ul The CALHM1 (22042-1-AP) by Proteintech is a Polyclonal antibody targeting CALHM1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22042-1-AP targets CALHM1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Calcium homeostasis modulator 1 (CALHM1) is a membrane protein with four transmembrane helices that form an octameric ion channel with voltage-dependent activation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14938 Product name: Recombinant human CALHM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-346 aa of BC036193 Sequence: CTEHAKAFAKVCIQQFFEAMNHDLELGHTNGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV Predict reactive species Full Name: calcium homeostasis modulator 1 Calculated Molecular Weight: 346 aa, 38 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC036193 Gene Symbol: CALHM1 Gene ID (NCBI): 255022 RRID: AB_11182709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IU99 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.