Proteintech, 22056-1-AP, ZFP161 / ZBTB14 Polyclonal antibody

Size: 20ul / 150ul The ZFP161 / ZBTB14 (22056-1-AP) by Proteintech is a Polyclonal antibody targeting ZFP161 / ZBTB14 in WB, ELISA applications with reactivity to human samples 22056-1-AP targets ZFP161 / ZBTB14 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ZBTB14, also named as :ZFP161, ZNF478, is a 449 amino acid protein, which interacts with ZBTB21. ZBTB14, is a transcriptional activator of the dopamine transporter (DAT), binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. ZBTB14 Binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. The calculated MW of ZFP161 is 52 kDa, 22056-1-AP can detect a band around 55 kDa. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17082 Product name: Recombinant human ZFP161 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 103-449 aa of BC110519 Sequence: EDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS Predict reactive species Full Name: zinc finger protein 161 homolog (mouse) Calculated Molecular Weight: 449 aa, 51 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC110519 Gene Symbol: ZFP161 Gene ID (NCBI): 7541 RRID: AB_3085683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43829 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.