Proteintech, 22058-1-AP, B9D2 Polyclonal antibody

Size: 20ul / 150ul The B9D2 (22058-1-AP) by Proteintech is a Polyclonal antibody targeting B9D2 in IHC, ELISA applications with reactivity to human samples 22058-1-AP targets B9D2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17104 Product name: Recombinant human B9D2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-175 aa of BC004444 Sequence: MAEVHVIGQIMGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC Predict reactive species Full Name: B9 protein domain 2 Calculated Molecular Weight: 175 aa, 19 kDa GenBank Accession Number: BC004444 Gene Symbol: B9D2 Gene ID (NCBI): 80776 RRID: AB_2878981 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BPU9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.