Iright
BRAND / VENDOR: Proteintech

Proteintech, 22066-1-AP, CHKB Polyclonal antibody

CATALOG NUMBER: 22066-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CHKB (22066-1-AP) by Proteintech is a Polyclonal antibody targeting CHKB in WB, ELISA applications with reactivity to human samples 22066-1-AP targets CHKB in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17142 Product name: Recombinant human CHKB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC101488 Sequence: MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVL Predict reactive species Full Name: choline kinase beta Calculated Molecular Weight: 395 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC101488 Gene Symbol: CHKB Gene ID (NCBI): 1120 RRID: AB_3669385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y259 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924