Proteintech, 22066-1-AP, CHKB Polyclonal antibody

Size: 20ul / 150ul The CHKB (22066-1-AP) by Proteintech is a Polyclonal antibody targeting CHKB in WB, ELISA applications with reactivity to human samples 22066-1-AP targets CHKB in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17142 Product name: Recombinant human CHKB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC101488 Sequence: MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVL Predict reactive species Full Name: choline kinase beta Calculated Molecular Weight: 395 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC101488 Gene Symbol: CHKB Gene ID (NCBI): 1120 RRID: AB_3669385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y259 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.