Iright
BRAND / VENDOR: Proteintech

Proteintech, 22068-1-AP, UNC5A Polyclonal antibody

CATALOG NUMBER: 22068-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UNC5A (22068-1-AP) by Proteintech is a Polyclonal antibody targeting UNC5A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22068-1-AP targets UNC5A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, PC-3 cells Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UNC5A, also named as KIAA1976 and UNC5H1, belongs to the unc-5 family. It is a receptor for netrin required for axon guidance. It mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC, which may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with the netrin ligand. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17155 Product name: Recombinant human UNC5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-504 aa of BC157824 Sequence: IVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLCVHTASGPEDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAEEFVSRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTLLSPIVS Predict reactive species Full Name: unc-5 homolog A (C. elegans) Calculated Molecular Weight: 842 aa, 93 kDa Observed Molecular Weight: 88-100 kDa GenBank Accession Number: BC157824 Gene Symbol: UNC5A Gene ID (NCBI): 90249 RRID: AB_11182161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZN44 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924