Product Description
Size: 20ul / 150ul
The ZNF718 (22074-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF718 in IF/ICC, ELISA applications with reactivity to human samples
22074-1-AP targets ZNF718 in IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17216 Product name: Recombinant human ZNF718 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 311-431 aa of BC104027 Sequence: FSCEECGNVFTTSSDFAKHKRIHTGEKPYKCEECGKSFNRSTTLTTHKRIHTGEKPYTCEECGKAFNWSSTLNVHKRIHSGKNPYKCEDCGKAFKVFANLHNHKKIHTGEKPYICKQCGKA Predict reactive species
Full Name: zinc finger protein 718
Calculated Molecular Weight: 478 aa, 55 kDa
GenBank Accession Number: BC104027
Gene Symbol: ZNF718
Gene ID (NCBI): 255403
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q3SXZ3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924