Proteintech, 22092-1-AP, IMPDH1 Polyclonal antibody

Size: 20ul / 150ul The IMPDH1 (22092-1-AP) by Proteintech is a Polyclonal antibody targeting IMPDH1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 22092-1-AP targets IMPDH1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse spleen tissue, A431 cells, K-562 cells, Raji cells, rat spleen tissue Positive IP detected in: HeLa cells Positive IHC detected in: human tonsillitis tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:800-1:3200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information IMPDH1(Inosine-5'-monophosphate dehydrogenase 1) is also named as IMPD1, IMP dehydrogenase 1 and belongs to the IMPDH/GMPR family. It catalyzes the rate limiting step of de novo guanine synthesis and an important target for the development of drugs with both chemotherapeutic and immunosuppressive activity. It may also have a role in the development of malignancy and the growth progression of some tumors. This protein has some isoforms produced by alternative splicing with the molecular mass of 53-65 kDa. This antibody may has cross reaction with IMPDH2 due to their high homology. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17297 Product name: Recombinant human IMPDH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-235 aa of BC033622 Sequence: LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV Predict reactive species Full Name: IMP (inosine monophosphate) dehydrogenase 1 Calculated Molecular Weight: 563 aa, 60 kDa Observed Molecular Weight: 53-60 kDa GenBank Accession Number: BC033622 Gene Symbol: IMPDH1 Gene ID (NCBI): 3614 RRID: AB_2878992 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20839 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.