Iright
BRAND / VENDOR: Proteintech

Proteintech, 22141-1-AP, FUT4 Polyclonal antibody

CATALOG NUMBER: 22141-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FUT4 (22141-1-AP) by Proteintech is a Polyclonal antibody targeting FUT4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 22141-1-AP targets FUT4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, A431 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FUT4, also named as ELFT and FCT3A, belongs to the glycosyltransferase 10 family. FUT4 may catalyze alpha-1,3 glycosidic linkages involved in the expression of Lewis X/SSEA-1 and VIM-2 antigens. The expression of CD15 (acts as a terminal glycotope in glycoproteins and glycolipids) is directed by FUT4 in promyelocytes and monocytes. FUT4 is an antigenic epitope defined as a Lewis X carbohydrate structure is expressed on murine embryonal carcinoma cells (EC), murine ES and iPS cells, and murine and human germ cells. It is widely used as a positive surface marker for mouse undifferentiated ES and iPS cells and a negative surface marker for human undifferentiated ES and iPS cells. Expression is down-regulated following differentiation of murine EC and ES cells, while the differentiation of human EC and ES cells is accompanied by an increase in FUT4 expression. FUT4 is associated with cell adhesion, migration and differentiation. 22141-1-AP detects the band around 45 kDa and glycosylated isoform 63 kDa protein in SDS-PAGE. (PMID: 22287018, 17335083, 11278338) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17565 Product name: Recombinant human FUT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-407 aa of BC136374 Sequence: QLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARY Predict reactive species Full Name: fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific) Calculated Molecular Weight: 530 aa, 59 kDa Observed Molecular Weight: 45 kDa, 63 kDa GenBank Accession Number: BC136374 Gene Symbol: FUT4 Gene ID (NCBI): 2526 RRID: AB_2879006 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22083 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924