Proteintech, 22142-1-AP, RCC1 Polyclonal antibody

Size: 20ul / 150ul The RCC1 (22142-1-AP) by Proteintech is a Polyclonal antibody targeting RCC1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, monkey samples 22142-1-AP targets RCC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, SH-SY5Y cells, COS-7 cells, HeLa cells, MCF-7 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human stomach tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:750-1:3000 Background Information CHC1, also named as RCC1, promotes the exchange of ran-bound gdp by gtp. It is involved in the regulation of onset of chromosome condensation in the S-phase. Phosphorylation of RCC1 on serines located in or near its nuclear localization signal activates RCC1 to generate RanGTP on mitotic chromosomes, which is required for spindle assembly and chromosome segregation. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human RCC1. Specification Tested Reactivity: human, mouse, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17569 Product name: Recombinant human RCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-421 aa of BC010067 Sequence: AEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Predict reactive species Full Name: regulator of chromosome condensation 1 Calculated Molecular Weight: 421 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC010067 Gene Symbol: RCC1 Gene ID (NCBI): 1104 RRID: AB_11183045 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18754 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.