Proteintech, 22157-1-AP, C3orf10 Polyclonal antibody

Size: 20ul / 150ul The C3orf10 (22157-1-AP) by Proteintech is a Polyclonal antibody targeting C3orf10 in IHC, ELISA applications with reactivity to human, mouse, rat samples 22157-1-AP targets C3orf10 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17793 Product name: Recombinant human C3orf10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC019303 Sequence: MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT Predict reactive species Full Name: chromosome 3 open reading frame 10 Calculated Molecular Weight: 9 kDa GenBank Accession Number: BC019303 Gene Symbol: C3orf10 Gene ID (NCBI): 55845 RRID: AB_2879010 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.