Iright
BRAND / VENDOR: Proteintech

Proteintech, 22192-1-AP, CHRNB4 Polyclonal antibody

CATALOG NUMBER: 22192-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CHRNB4 (22192-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNB4 in WB, ELISA applications with reactivity to human, mouse samples 22192-1-AP targets CHRNB4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HeLa cells, mouse testis tissue Positive FC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16767 Product name: Recombinant human CHRNB4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 332-451 aa of BC096080 Sequence: WVKRCFLHKLPTFLFMKRPGPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVEDW Predict reactive species Full Name: cholinergic receptor, nicotinic, beta 4 Calculated Molecular Weight: 498 aa, 56 kDa Observed Molecular Weight: 48-60 kDa GenBank Accession Number: BC096080 Gene Symbol: CHRNB4 Gene ID (NCBI): 1143 RRID: AB_11232227 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30926 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924