Product Description
Size: 20ul / 150ul
The CHRNB4 (22192-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNB4 in WB, ELISA applications with reactivity to human, mouse samples
22192-1-AP targets CHRNB4 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: SH-SY5Y cells, HeLa cells, mouse testis tissue
Positive FC detected in: SH-SY5Y cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag16767 Product name: Recombinant human CHRNB4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 332-451 aa of BC096080 Sequence: WVKRCFLHKLPTFLFMKRPGPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVEDW Predict reactive species
Full Name: cholinergic receptor, nicotinic, beta 4
Calculated Molecular Weight: 498 aa, 56 kDa
Observed Molecular Weight: 48-60 kDa
GenBank Accession Number: BC096080
Gene Symbol: CHRNB4
Gene ID (NCBI): 1143
RRID: AB_11232227
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P30926
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924