Proteintech, 22193-1-AP, SNX21 Polyclonal antibody

Size: 20ul / 150ul The SNX21 (22193-1-AP) by Proteintech is a Polyclonal antibody targeting SNX21 in WB, IHC, ELISA applications with reactivity to human samples 22193-1-AP targets SNX21 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SNX21, also named as C20orf161 and SNXL, is a member of the sorting nexin family. It binds to membranes enriched in phosphatidylinositol 3-phosphate (PtdIns(P3)) and phosphatidylinositol 4,5-bisphosphate. It is involved in several stages of intracellular trafficking. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16900 Product name: Recombinant human SNX21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC019823 Sequence: MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDEDDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANVVKDPPSKYVLYTLTVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPQSH Predict reactive species Full Name: sorting nexin family member 21 Calculated Molecular Weight: 373 aa, 41 kDa Observed Molecular Weight: ~40 kDa GenBank Accession Number: BC019823 Gene Symbol: SNX21 Gene ID (NCBI): 90203 RRID: AB_2879022 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969T3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.