Proteintech, 22215-1-AP, Kindlin 1 Polyclonal antibody

Size: 20ul / 150ul The Kindlin 1 (22215-1-AP) by Proteintech is a Polyclonal antibody targeting Kindlin 1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 22215-1-AP targets Kindlin 1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, COLO 320 cells, HEK-293 cells Positive IHC detected in: human colon cancer tissue, human pancreas tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Kindlin-1 is a FERM domain containing adaptor protein that is found predominantly at cell-extracellular matrix adhesions where it binds to β-integrin subunits and is required for integrin activation. Loss of function mutations in the FERMT1 gene which encodes Kindlin-1 leads to the development of Kindler Syndrome (KS) an autosomal recessive skin disorder characterized by skin blistering, photosensitivity, and predisposition to aggressive squamous cell carcinoma (SCC). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17543 Product name: Recombinant human Kindlin 1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-420 aa of BC035882 Sequence: HISKLSLSAETQDFAGESEVDEIEAALSNLEVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL Predict reactive species Full Name: fermitin family homolog 1 (Drosophila) Calculated Molecular Weight: 677 aa, 77 kDa Observed Molecular Weight: 70-77 kDa GenBank Accession Number: BC035882 Gene Symbol: Kindlin 1 Gene ID (NCBI): 55612 RRID: AB_2879033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.