Proteintech, 22221-1-AP, Cytokeratin 14 Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 14 (22221-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 14 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 22221-1-AP targets Cytokeratin 14 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, rat skin tissue Positive IP detected in: mouse skin tissue Positive IHC detected in: human skin tissue, human bowen diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis. This antibody is specifically against KRT14. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17559 Product name: Recombinant human KRT14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 426-472 aa of BC002690 Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN Predict reactive species Full Name: keratin 14 Calculated Molecular Weight: 472 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC002690 Gene Symbol: Cytokeratin 14 Gene ID (NCBI): 3861 RRID: AB_2879036 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02533 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.