Iright
BRAND / VENDOR: Proteintech

Proteintech, 22225-1-AP, MPO Polyclonal antibody

CATALOG NUMBER: 22225-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MPO (22225-1-AP) by Proteintech is a Polyclonal antibody targeting MPO in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 22225-1-AP targets MPO in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, U-937 cells Positive IP detected in: HL-60 cells Positive IHC detected in: human colon cancer tissue, human liver tissue, human spleen tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue, mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing. This antibody is specific to MPO. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17564 Product name: Recombinant human MPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 606-657 aa of BC130476 Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV Predict reactive species Full Name: myeloperoxidase Calculated Molecular Weight: 745 aa, 84 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC130476 Gene Symbol: MPO Gene ID (NCBI): 4353 RRID: AB_2879037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05164 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924