Proteintech, 22230-1-AP, Cytokeratin 17 Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 17 (22230-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 17 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 22230-1-AP targets Cytokeratin 17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IHC detected in: human bowen disease, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 17 is a type I cytokeratin. It is found in nail beds, hair follicles, sebaceous glands, and other epidermal appendages. It is used as a marker for trauma. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17575 Product name: Recombinant human KRT17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC000159 Sequence: MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKAT Predict reactive species Full Name: keratin 17 Calculated Molecular Weight: 432 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC000159 Gene Symbol: Cytokeratin 17 Gene ID (NCBI): 3872 RRID: AB_2879040 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q04695 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.