Proteintech, 22232-1-AP, KIRREL Polyclonal antibody

Size: 20ul / 150ul The KIRREL (22232-1-AP) by Proteintech is a Polyclonal antibody targeting KIRREL in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 22232-1-AP targets KIRREL in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells, mouse brain tissue, mouse kidney tissue, mouse lung tissue, rat brain tissue Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Kin of IRRE protein (KIRREL), also known as NEPH1, is a member of a podocin-binding protein family. KIRREL is a component of the podocyte slit diaphragm, which serves as the structural framework of the glomerular filtration barrier. KIRREL has three isoforms with molecular weights of 85 kDa, 83 kDa, and 72 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17578 Product name: Recombinant human KIRREL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 607-757 aa of BC109192 Sequence: NVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYAQLNTYSRGPASDYGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAGYPTYRLGYPQAPPSGLERTPYEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV Predict reactive species Full Name: kin of IRRE like (Drosophila) Calculated Molecular Weight: 757 aa, 84 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC109192 Gene Symbol: KIRREL Gene ID (NCBI): 55243 RRID: AB_3085689 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96J84 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.