Proteintech, 22233-1-AP, C4 Alpha Chain/C4b/C4d Polyclonal antibody

Size: 20ul / 150ul The C4 Alpha Chain/C4b/C4d (22233-1-AP) by Proteintech is a Polyclonal antibody targeting C4 Alpha Chain/C4b/C4d in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 22233-1-AP targets C4 Alpha Chain/C4b/C4d in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L02 cells, human blood, mouse liver tissue Positive IP detected in: L02 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:4000-1:40000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular wights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1017-1336aa of human C4-A protein can recognize C4 precursor, C4 alpha chain, C4b, and C4d. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17583 Product name: Recombinant human C4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1017-1336 aa of BC063289 Sequence: YLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEIASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTQAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR Predict reactive species Full Name: complement component 4A (Rodgers blood group) Calculated Molecular Weight: 1744 aa, 193 kDa Observed Molecular Weight: 80-95 kDa, 200 kDa GenBank Accession Number: BC063289 Gene Symbol: C4 Gamma Chain Gene ID (NCBI): 720 RRID: AB_2879042 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0C0L4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.