Iright
BRAND / VENDOR: Proteintech

Proteintech, 22238-1-AP, CEACAM1/CD66a Polyclonal antibody

CATALOG NUMBER: 22238-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CEACAM1/CD66a (22238-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM1/CD66a in IHC, ELISA applications with reactivity to human samples 22238-1-AP targets CEACAM1/CD66a in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CEACAM1, also known as CD66a or BGP (biliary glycoprotein), is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in the control of cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). CEACAM1 is a transmembrane glycoprotein that is expressed on epithelial, endothelial, and immune cells (PMID: 30314283). CEACAM1 has been demonstrated to play a role in morphogenesis, apoptosis, angiogenesis, cell proliferation, cell motility, fibrosis, and immunity (PMID: 31604530). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17651 Product name: Recombinant human CEACAM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 317-459 aa of BC014473 Sequence: IVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGR Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) Calculated Molecular Weight: 526 aa, 58 kDa GenBank Accession Number: BC014473 Gene Symbol: CEACAM1 Gene ID (NCBI): 634 RRID: AB_3669392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13688 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924