Iright
BRAND / VENDOR: Proteintech

Proteintech, 22244-1-AP, CALCA/Calcitonin Polyclonal antibody

CATALOG NUMBER: 22244-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CALCA/Calcitonin (22244-1-AP) by Proteintech is a Polyclonal antibody targeting CALCA/Calcitonin in WB, IP, ELISA applications with reactivity to human samples 22244-1-AP targets CALCA/Calcitonin in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: TT cells, Transfected HEK-293 cells Positive IP detected in: TT cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Calcitonin is a peptide hormone consisting of 32 amino acids, primarily synthesized by the parafollicular cells (C cells) of the human thyroid gland. It plays a crucial role in regulating calcium levels in the blood by decreasing them. Calcitonin opposes the actions of parathyroid hormone, which increases blood calcium levels. Calcitonin works through a G protein-coupled receptor, known as the calcitonin receptor, which predominantly transmits signals via the cAMP and PLC/IP3 pathways. Its primary physiological effects are on osteoclasts and the tubular epithelium of kidneys. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17737 Product name: Recombinant human CALCA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-141 aa of BC093753 Sequence: ELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN Predict reactive species Full Name: Calcitonin Calculated Molecular Weight: 141 aa, 15 kDa Observed Molecular Weight: 14 kDa, 5 kDa GenBank Accession Number: BC093753 Gene Symbol: CALCA Gene ID (NCBI): 796 RRID: AB_3669393 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01258 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924