Iright
BRAND / VENDOR: Proteintech

Proteintech, 22341-1-AP, L-VEGFA Polyclonal antibody

CATALOG NUMBER: 22341-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The L-VEGFA (22341-1-AP) by Proteintech is a Polyclonal antibody targeting L-VEGFA in WB, IHC, ELISA applications with reactivity to human samples 22341-1-AP targets L-VEGFA in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, bEnd.3 cells, SH-SY5Y cells Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information VEGFA, also named as VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17831 Product name: Recombinant human L-VEGFA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC065522 Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETM Predict reactive species Full Name: vascular endothelial growth factor A Calculated Molecular Weight: 412 aa, 46 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC065522 Gene Symbol: VEGFA Gene ID (NCBI): 7422 RRID: AB_2879080 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15692 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924