Proteintech, 22361-1-AP, ATP2A1 Polyclonal antibody

Size: 20ul / 150ul The ATP2A1 (22361-1-AP) by Proteintech is a Polyclonal antibody targeting ATP2A1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 22361-1-AP targets ATP2A1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human skeletal muscle tissue, human heart tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ATP2A1 also known as SERCA1, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen and is involved in muscular excitation and contraction. Mutations in ATP2A1 cause some autosomal recessive forms of Brody disease(PMID: 23911890, 10914677). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17944 Product name: Recombinant human ATP2A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 561-635 aa of BC037354 Sequence: RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG Predict reactive species Full Name: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 Calculated Molecular Weight: 1001 aa, 110 kDa Observed Molecular Weight: 116 kDa GenBank Accession Number: BC037354 Gene Symbol: ATP2A1 Gene ID (NCBI): 487 RRID: AB_2879089 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O14983 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.