Proteintech, 22381-1-AP, TTI1 Polyclonal antibody

Size: 20ul / 150ul The TTI1 (22381-1-AP) by Proteintech is a Polyclonal antibody targeting TTI1 in WB, IP, ELISA applications with reactivity to human samples 22381-1-AP targets TTI1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Telomere maintenance 2-interacting protein 1 (TTI1), also known as KIAA0406 or SMG10, is one of the members of the conserved Triple T (TTT) complex, which is composed of telo a regulator of DNA damage and repair. TTI1 is expressed in numerous organisms and is assumed to play a central role in regulating a wide spectrum of DNA damage responses, telomere maintenance, and checkpoint signaling (PMID: 20427287). Knockdown of Tti1 suppresses phosphorylation of both mTORC1 substrates (S6K1 and 4E-BP1) and an mTORC2 substrate (Akt) (PMID: 40514657) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17697 Product name: Recombinant human KIAA0406 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 740-1089 aa of BC013755 Sequence: DVLATLDQFYDKRAASFVSVLHALMAALAQWFPDTGNLGHLQEQSLGEEGSHLNQRPAALEKSTTTAEDIEQFLLNYLKEKDVADGNVSDFDNEEEEQSVPPKVDENDTRPDVEPPLPLQIQIAMDVMERCIHLLSDKNLQIRLKVLDVLDLCVVVLQSHKNQLLPLAHQAWPSLVHRLTRDAPLAVLRAFKVLRTLGSKCGDFLRSRFCKDVLPKLAGSLVTQAPISARAGPVYSHTLAFKLQLAVLQGLGPLCERLDLGEGDLNKVADACLIYLSVKQPVKLQEAARSVFLHLMKVDPDSTWFLLNELYCPVQFTPPHPSLHPVQLHGASGQQNPYTTNVLQLLKELQ Predict reactive species Full Name: KIAA0406 Calculated Molecular Weight: 1089 aa, 122 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC013755 Gene Symbol: TTI1 Gene ID (NCBI): 9675 RRID: AB_2879094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O43156 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.