Iright
BRAND / VENDOR: Proteintech

Proteintech, 22411-1-AP, IQSEC3 Polyclonal antibody

CATALOG NUMBER: 22411-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IQSEC3 (22411-1-AP) by Proteintech is a Polyclonal antibody targeting IQSEC3 in WB, ELISA applications with reactivity to human, mouse, rat samples 22411-1-AP targets IQSEC3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information IQSEC3, a gephyrin-binding GABAergic (gamma-aminobutyric acidergic) synapse-specific guanine nucleotide exchange factor, is expressed specifically in the adult brain, predominantly in the cerebral cortex and the olfactory bulb, but not in the fetal brain. IQSEC3 was recently reported to regulate activity-dependent GABAergic synapse maturation, Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18117 Product name: Recombinant human IQSEC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC024764 Sequence: MESLLENPVRAVLYLKELTAIVQNQQSLIHSQRERIDELERRLDELSAENRSLWEHQQLLQAQPPPGLVPPSSAPLPAAPATAPAAAARAQEPLQDQGQRSAAAPHPAPDRPPRQHHGQLLEQPQRGPGSRAHTPQSPHKHLGTQGAVTDKEKERPPSCCAAAGALLQHKSPSALGKGVLSRRPE Predict reactive species Full Name: IQ motif and Sec7 domain 3 Calculated Molecular Weight: 1182 aa, 128 kDa Observed Molecular Weight: 128 kDa GenBank Accession Number: BC024764 Gene Symbol: IQSEC3 Gene ID (NCBI): 440073 RRID: AB_3085697 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9UPP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924