Iright
BRAND / VENDOR: Proteintech

Proteintech, 22463-1-AP, CD1e Polyclonal antibody

CATALOG NUMBER: 22463-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD1e (22463-1-AP) by Proteintech is a Polyclonal antibody targeting CD1e in WB, ELISA applications with reactivity to human samples 22463-1-AP targets CD1e in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MOLT-4 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CD1e molecule (CD1e, also known as R2 and CD1A) is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin (PMID: 10948205). The discoverers of the CD1 locus originally separated CD1 proteins into group 1 (CD1a, CD1b, and CD1c) and group 2 (CD1d), based on amino acid sequence homology (PMID: 2467814). CD1e is an important modulator of group 1 and group 2 CD1-restricted responses influencing the lipid antigen availability and the generation and persistence of CD1-lipid complexes (PMID: 21844346). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18008 Product name: Recombinant human CD1E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-219 aa of BC131693 Sequence: APQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGP Predict reactive species Full Name: CD1e molecule Calculated Molecular Weight: 388 aa, 44 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC131693 Gene Symbol: CD1E Gene ID (NCBI): 913 RRID: AB_3669398 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P15812 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924