Proteintech, 22496-1-AP, LLGL1 Polyclonal antibody

Size: 20ul / 150ul The LLGL1 (22496-1-AP) by Proteintech is a Polyclonal antibody targeting LLGL1 in WB, IF/ICC, ELISA applications with reactivity to human samples 22496-1-AP targets LLGL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Lethal giant larvae (Lgl) is a scaffolding protein that regulates the establishment of apical-basal polarity in epithelial cells. The human homologs of Lgl are known as LLGL1 and LLGL2. LLGL1 is a tumor suppressor in multiple human cancers, including hepatocellular carcinoma, malignant melanoma, and colorectal cancer (PMID: 34178676; 15735678; 16170365). LLGL2 functions as a promoter of tumor growth and not as a tumor suppressor in ER+ breast cancer (PMID: 30996345). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18057 Product name: Recombinant human LLGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-212 aa of BC151838 Sequence: EFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAAGDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKIL Predict reactive species Full Name: lethal giant larvae homolog 1 (Drosophila) Calculated Molecular Weight: 1064 aa, 115 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC151838 Gene Symbol: LLGL1 Gene ID (NCBI): 3996 RRID: AB_3669400 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q15334 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.