Iright
BRAND / VENDOR: Proteintech

Proteintech, 22496-1-AP, LLGL1 Polyclonal antibody

CATALOG NUMBER: 22496-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LLGL1 (22496-1-AP) by Proteintech is a Polyclonal antibody targeting LLGL1 in WB, IF/ICC, ELISA applications with reactivity to human samples 22496-1-AP targets LLGL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Lethal giant larvae (Lgl) is a scaffolding protein that regulates the establishment of apical-basal polarity in epithelial cells. The human homologs of Lgl are known as LLGL1 and LLGL2. LLGL1 is a tumor suppressor in multiple human cancers, including hepatocellular carcinoma, malignant melanoma, and colorectal cancer (PMID: 34178676; 15735678; 16170365). LLGL2 functions as a promoter of tumor growth and not as a tumor suppressor in ER+ breast cancer (PMID: 30996345). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18057 Product name: Recombinant human LLGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-212 aa of BC151838 Sequence: EFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAAGDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKIL Predict reactive species Full Name: lethal giant larvae homolog 1 (Drosophila) Calculated Molecular Weight: 1064 aa, 115 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC151838 Gene Symbol: LLGL1 Gene ID (NCBI): 3996 RRID: AB_3669400 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q15334 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924