Product Description
Size: 20ul / 150ul
The EAAT2 (22515-1-AP) by Proteintech is a Polyclonal antibody targeting EAAT2 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples
22515-1-AP targets EAAT2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Positive IP detected in: mouse brain tissue
Positive IF-P detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE. (PMID: 22114258)
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18247 Product name: Recombinant human SLC1A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species
Full Name: solute carrier family 1 (glial high affinity glutamate transporter), member 2
Calculated Molecular Weight: 574 aa, 62 kDa
Observed Molecular Weight: 60-70 kDa, 140 kDa
GenBank Accession Number: BC132768
Gene Symbol: EAAT2
Gene ID (NCBI): 6506
RRID: AB_2879112
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P43004
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924