Proteintech, 22524-1-AP, Dopamine Transporter/DAT Polyclonal antibody

Size: 20ul / 150ul The Dopamine Transporter/DAT (22524-1-AP) by Proteintech is a Polyclonal antibody targeting Dopamine Transporter/DAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 22524-1-AP targets Dopamine Transporter/DAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF-Fro detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information DAT, also name as SLC6A3, is dopamine transporter which is a member of the sodium- and chloride- dependent neurotransmitter transporter family. Dopamine(DA) released from neurons is cleared by the DA transporter (DAT). Altered dopaminergic signaling is linked to multiple neuropsychiatric disorders, such as attention deficit hyperactive disorder, mood disorders, schizophrenia, autism and so on (PMID:30755521). 22524-1-AP can detect 70~80kDa band, which is consistent with the report (PMID:12746456). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18297 Product name: Recombinant human SLC6A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC133003 Sequence: MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 Calculated Molecular Weight: 620 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC133003 Gene Symbol: DAT Gene ID (NCBI): 6531 RRID: AB_2879116 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01959 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.