Iright
BRAND / VENDOR: Proteintech

Proteintech, 22553-1-AP, FAM129B Polyclonal antibody

CATALOG NUMBER: 22553-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FAM129B (22553-1-AP) by Proteintech is a Polyclonal antibody targeting FAM129B in WB, IHC, ELISA applications with reactivity to human, mouse samples 22553-1-AP targets FAM129B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, A431 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM129B, also named as Niban-like protein 1 or C9orf88, is a 746 amino acid protein, which contains one PH domain and belongs to the Niban family. FAM129B localizes in the cytoplasm and may play a role in apoptosis suppression and promote melanoma cell invasion in vitro. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18314 Product name: Recombinant human FAM129B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-341 aa of BC067366 Sequence: DARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALM Predict reactive species Full Name: family with sequence similarity 129, member B Calculated Molecular Weight: 733 aa, 83 kDa Observed Molecular Weight: 83-93 kDa GenBank Accession Number: BC067366 Gene Symbol: FAM129B Gene ID (NCBI): 64855 RRID: AB_2879121 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96TA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924