Proteintech, 22560-1-AP, HEATR6 Polyclonal antibody

Size: 20ul / 150ul The HEATR6 (22560-1-AP) by Proteintech is a Polyclonal antibody targeting HEATR6 in WB, IP, ELISA applications with reactivity to human samples 22560-1-AP targets HEATR6 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IP detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information HEAT repeat-containing protein 6 (HEATR6) is amplified in certain breast cancer cell lines, such as MCF-7 and BT-474, suggesting its role in cancer progression. Additionally, HEATR6 is implicated in the regulation of gene expression, particularly in the context of long non-coding RNAs (lncRNAs) associated with breast cancer (PMID: 30953646). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18437 Product name: Recombinant human HEATR6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 832-1181 aa of BC119813 Sequence: AATSRALGVYVLFPCLRQDVIFVADAANAILMSLEDKSLNVRAKAAWSLGNLTDTLIVNMETPDPSFQEEFSGLLLLKMLRSAIEASKDKDKVKSNAVRALGNLLHFLQPSHIEKPTFAEIIEESIQALISTVLTEAAMKVRWNACYAMGNVFKNPALPLGTAPWTSQAYNALTSVVTSCKNFKVRIRSAAALSVPGKREQYGSVDQYARIWNALVTALQKSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGALPGLTNQ Predict reactive species Full Name: HEAT repeat containing 6 Calculated Molecular Weight: 1181 aa, 129 kDa Observed Molecular Weight: 129 kDa GenBank Accession Number: BC119813 Gene Symbol: HEATR6 Gene ID (NCBI): 63897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q6AI08 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.