Proteintech, 22578-1-AP, ARAP3 Polyclonal antibody

Size: 20ul / 150ul The ARAP3 (22578-1-AP) by Proteintech is a Polyclonal antibody targeting ARAP3 in IHC, ELISA applications with reactivity to human samples 22578-1-AP targets ARAP3 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The ADP-ribosylation factor (ARF) family of small GTP-binding proteins are involved in vesicular transport regulation and in controlling cytoskeletal organization and cell adhesion. These proteins are best characterized as regulators of membrane traffic. The Centaurin GTPase-activating protein family comprise a subset of ARF regulatory molecules that transduce PI 3-kinase activation into coordinated control of ARF-dependent pathways. ARAP3 (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3) is unique for its dual specificity GAPs (GTPase activating protein) activity for Arf6 (ADP-ribosylation factor 6) and RhoA (Ras homolog gene family member A) regulated by PtdIns(3,4,5)P3 (phosphatidylinositol (3,4,5)-trisphosphate) and a small GTPase Rap1-GTP and is involved in regulation of cell shape and adhesion. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17436 Product name: Recombinant human ARAP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1225-1544 aa of BC009968 Sequence: PRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLKEKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSILKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLTSQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGETTAGLGSPSQPTSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT Predict reactive species Full Name: ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 Calculated Molecular Weight: 1544 aa, 170 kDa GenBank Accession Number: BC009968 Gene Symbol: ARAP3 Gene ID (NCBI): 64411 RRID: AB_2879125 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.