Proteintech, 22632-1-AP, Plakophilin 1 Polyclonal antibody

Size: 20ul / 150ul The Plakophilin 1 (22632-1-AP) by Proteintech is a Polyclonal antibody targeting Plakophilin 1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 22632-1-AP targets Plakophilin 1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HaCaT cells, mouse skin tissue, rat skin tissue Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Plakophilin 1, also known as PKP1, B6P, is a member of the arm-repeat protein family. PKP1 contains arm-repeat (armadillo) domains, localizes to nuclei and cell desmosomes, and participates in linking cadherins to intermediate filaments in the cytoskeleton (PMID: 10747098). PKP1 contributes to epidermal morphogenesis and facilitates the formation of intermediate filaments. Mutations in PKP1 have been associated with the ectodermal dysplasia/skin fragility syndrome (PubMed:9326952, 10852826). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18153 Product name: Recombinant human PKP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 412-726 aa of BC114571 Sequence: NLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF Predict reactive species Full Name: plakophilin 1 (ectodermal dysplasia/skin fragility syndrome) Calculated Molecular Weight: 747 aa, 83 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC114571 Gene Symbol: PKP1 Gene ID (NCBI): 5317 RRID: AB_3085701 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13835 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.