Iright
BRAND / VENDOR: Proteintech

Proteintech, 22644-1-AP, ESRRB Polyclonal antibody

CATALOG NUMBER: 22644-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ESRRB (22644-1-AP) by Proteintech is a Polyclonal antibody targeting ESRRB in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 22644-1-AP targets ESRRB in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-13 cells, A549 cells Positive IP detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Estrogen related receptor beta (ESRRB), a NR3 Steroid Receptor, has been shown to affect early placental development. Also it can act as a repressor of transcriptional activity mediated by the glucocorticoid receptor (GR). It binds as a monomer to the extended half-site TNAAGTGCA and as a homodimer to the estrogen response element (ERE), palindromic thyroid hormone response element (TRE(pal)), and SF-1 response element, but not to the glucocorticoid response element (GRE). Estrogen related receptor beta mutations lead to abnormal development of the chorion and defective diploid trophoblast proliferation, and are lethal during midgestation. Expression has been documented in mice in the extra embryonic ectoderm that gives rise to the chorion. ESTs have been isolated from normal human eye, lung, and testis libraries. The ligand for the receptor is PPARgamma coactivator 1 (PGC-1) beta. ESRRB exists various isoforms and molecular weight of each isoform is 48 kDa,55 kDa and 56 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18523 Product name: Recombinant human ESRRB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC131517 Sequence: MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKC Predict reactive species Full Name: estrogen-related receptor beta Calculated Molecular Weight: 508 aa, 56 kDa Observed Molecular Weight: 48-56 kDa GenBank Accession Number: BC131517 Gene Symbol: ESRRB Gene ID (NCBI): 2103 RRID: AB_2879140 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95718 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924