Proteintech, 22666-1-AP, HES5 Polyclonal antibody

Size: 20ul / 150ul The HES5 (22666-1-AP) by Proteintech is a Polyclonal antibody targeting HES5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22666-1-AP targets HES5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information HES5, also known as bHLHb38, has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG). HES5 is expressed in fetal heart and brain tumors. HES5 as a transcriptional repressor of genes that require a bHLH protein for their transcription and plays an important role as neurogenesis negative regulator. HES5 is detected with molecular weight of 41 kDa according to the publication (PMID: 24286475). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, mink Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18270 Product name: Recombinant human HES5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC087840 Sequence: MRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW Predict reactive species Full Name: hairy and enhancer of split 5 (Drosophila) Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC087840 Gene Symbol: HES5 Gene ID (NCBI): 388585 RRID: AB_2879147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5TA89 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.