Proteintech, 22691-1-AP, ZBTB17 Polyclonal antibody

Size: 20ul / 150ul The ZBTB17 (22691-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB17 in WB, ELISA applications with reactivity to human, mouse samples 22691-1-AP targets ZBTB17 in applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, THP-1 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information ZBTB17 (zinc finger and BTB domain protein 17), also known as MIZ1, is a highly conserved transcription factor in evolution. It is expressed in many cell types and plays an important role in many biological processes such as cell cycle regulation, immune cell development and metabolic regulation. ZBTB17 plays a key role in the early stage of T cell development. It ensures the normal development of T cells by regulating the expression of pre-TCR and inhibiting the activity of TP53. ZBTB17 plays an important role in cardiac stress response, and its absence may lead to cardiomyopathy and heart failure. At Lys-397 and Lys-481, it undergoes "Lys-48" linked ubiquitination, and then degrades proteasome in a TRAF2-dependent manner. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18396 Product name: Recombinant human ZBTB17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 454-803 aa of BC126163 Sequence: KFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAPECPPPAE Predict reactive species Full Name: zinc finger and BTB domain containing 17 Calculated Molecular Weight: 803 aa, 88 kDa Observed Molecular Weight: 88-100 kDa GenBank Accession Number: BC126163 Gene Symbol: ZBTB17 Gene ID (NCBI): 7709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q13105 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.