Iright
BRAND / VENDOR: Proteintech

Proteintech, 22838-1-AP, MALSU1 Polyclonal antibody

CATALOG NUMBER: 22838-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MALSU1 (22838-1-AP) by Proteintech is a Polyclonal antibody targeting MALSU1 in WB, IHC, ELISA applications with reactivity to human samples 22838-1-AP targets MALSU1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells, U-251 cells Positive IHC detected in: human testis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information C7orf30, also known as MALSU1, is a member of the iojap protein family. It was predicted to enable ribosomal large subunit binding activity. It was Involved in negative regulation of mitochondrial translation and ribosomal large subunit biogenesis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18286 Product name: Recombinant human C7orf30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC012331 Sequence: MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE Predict reactive species Full Name: Mitochondrial assembly of ribosomal large subunit protein 1 Calculated Molecular Weight: 234 aa, 26 kDa Observed Molecular Weight: 26-28 kDa GenBank Accession Number: BC012331 Gene Symbol: MALSU1 Gene ID (NCBI): 115416 RRID: AB_11182483 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EH3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924