Iright
BRAND / VENDOR: Proteintech

Proteintech, 22862-1-AP, ACSM2A Polyclonal antibody

CATALOG NUMBER: 22862-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ACSM2A (22862-1-AP) by Proteintech is a Polyclonal antibody targeting ACSM2A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 22862-1-AP targets ACSM2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, human brain tissue, rat liver tissue, mouse kidney tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ACSM2A(Acyl-coenzyme A synthetase ACSM2A, mitochondrial) is also named as ACSM2, MACS2 and belongs to the ATP-dependent AMP-binding enzyme family. It acts as a medium-chain fatty acid : CoA ligase with the caculated molecular weight of 64 kDa and acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18856 Product name: Recombinant human ACSM2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-390 aa of BC125176 Sequence: GTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILCSLMEPWALGACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSKTMKIKPGYMGTAASCY Predict reactive species Full Name: acyl-CoA synthetase medium-chain family member 2A Calculated Molecular Weight: 577 aa, 64 kDa Observed Molecular Weight: 60-64 kDa GenBank Accession Number: BC125176 Gene Symbol: ACSM2A Gene ID (NCBI): 123876 RRID: AB_2879181 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08AH3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924